PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA50G00032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 288aa    MW: 33518.3 Da    PI: 8.5784
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA50G00032genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.7e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed ll+d+v+q+G g+W++++r  g++R +k+c++rw +yl
       AA50G00032 16 KGPWTAQEDRLLIDYVRQHGEGRWNSVSRLAGLKRNGKSCRLRWVNYL 63
                     79********************************************97 PP

2Myb_DNA-binding47.15.4e-1570126247
                      SSS-HHHHHHHHHHHHHTTTT............-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGgg............tWktIartmgkgRtlkqcksrwqky 47 
                      g  T++E+ +++d+++++G+             +W+tIar ++ gRt++++k++w+++
       AA50G00032  70 GHITPQEETIILDLHAKWGNSlldsviyeiyiyRWSTIARSLP-GRTDNEIKNYWRTH 126
                      667****************************************.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.5031167IPR017930Myb domain
SuperFamilySSF466891.41E-2513123IPR009057Homeodomain-like
SMARTSM007174.0E-161565IPR001005SANT/Myb domain
PfamPF002495.4E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-231770IPR009057Homeodomain-like
CDDcd001675.69E-111863No hitNo description
PROSITE profilePS5129413.72668131IPR017930Myb domain
SMARTSM007171.5E-1068129IPR001005SANT/Myb domain
PfamPF002492.5E-1269126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2271130IPR009057Homeodomain-like
CDDcd001678.30E-873127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSMWSGWGLV EEGWRKGPWT AQEDRLLIDY VRQHGEGRWN SVSRLAGLKR NGKSCRLRWV  60
NYLRPDLKKG HITPQEETII LDLHAKWGNS LLDSVIYEIY IYRWSTIARS LPGRTDNEIK  120
NYWRTHFKKK TKSPTNNAEK TKNRILKKQQ FQQQRKIELQ QEQQLLQFNE LDDMKKIISL  180
LNDDDTDNNS SSSSSCNGNN NNNNNTFYVP HHITHSTTTT TTSSYDQSVT EQQLQRIYDN  240
SGTNFPVNEE NGIWEGLWNL DLEGHGSFGV STCAPSKHCF QNLPISFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-221613127128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285781.11e-116hypothetical protein CARUB_v10007255mg
RefseqXP_009102521.11e-116PREDICTED: myb-related protein 305-like
RefseqXP_013752037.11e-116PREDICTED: myb-related protein 305-like
TrEMBLM4DEV71e-116M4DEV7_BRARP; Uncharacterized protein
TrEMBLR0GP771e-116R0GP77_9BRAS; Uncharacterized protein
STRINGBra015029.1-P1e-116(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-91myb domain protein 305